Rab43 (NM_001039394) Mouse Recombinant Protein

CAT#: TP516803

Purified recombinant protein of Mouse RAB43, member RAS oncogene family (Rab43), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216803 representing NM_001039394
  Red=Cloning site Green=Tags(s)
  
  MAGPGPGDQDEHYDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRVKLQIW
  DTAGQERFRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADFREVP
  LAEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMRHGGPMFSEKNTDHIQLDSKDIAESWGCGC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034483
• Locus ID: 69834
• UniProt ID: Q8CG50, Q0PD10
• Cytogenetics: 6 D1
• Refseq Size: 4605
• Refseq ORF: 630
• Synonyms: 1810048P08Rik; 2500004H21Rik; AW490415
• Summary: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium.[UniProtKB/Swiss-Prot Function]