March2 (NM_145486) Mouse Recombinant Protein

CAT#: TP516574

Purified recombinant protein of Mouse membrane-associated ring finger (C3HC4) 2 (March2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216574 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTGDCCHLPGSLCDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDSQSDCPFCRICHEG
  ANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC
  DMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT
  NQKVRLKIREADGSEDPHHSLLATGLLKKLQRFSPLSLRQEHGSIQGGMVQVELRVLHLRLKEASGRLTP
  RHLGQVH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663461
• Locus ID: 224703
• UniProt ID: Q8CA25
• Cytogenetics: 17 B1
• Refseq Size: 3452
• Refseq ORF: 864
• Synonyms: 9530046H09Rik; MARCH-II
• Summary: E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.[UniProtKB/Swiss-Prot Function]