Pdha2 (NM_008811) Mouse Recombinant Protein

CAT#: TP515676

Purified recombinant protein of Mouse pyruvate dehydrogenase E1 alpha 2 (Pdha2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR215676 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRKMLTAVLSHVFSGMVQKPALRGLLSSLKFSNDATCDIKKCDLYRLEEGPPTSTVLTRAEALKYYRTMQ
  VIRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELT
  GRKGGCAKGKGGSMHMYGKNFYGGNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYN
  MSALWKLPCVFICENNLYGMGTSNERSAASTDYHKKGFIIPGLRVNGMDILCVREATKFAADHCRSGKGP
  IVMELQTYRYHGHSMSDPGISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDA
  AQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032837
• Locus ID: 18598
• UniProt ID: P35487
• Cytogenetics: 3 H1
• Refseq Size: 2352
• Refseq ORF: 1176
• Synonyms: Pdhal
• Summary: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.[UniProtKB/Swiss-Prot Function]