Fam172a (NM_138312) Mouse Recombinant Protein

CAT#: TP512907

Purified recombinant protein of Mouse family with sequence similarity 172, member A (Fam172a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR212907 representing NM_138312
  Red=Cloning site Green=Tags(s)
  
  MSISLSSLIFLPIWINMAQMQQGGSNETEQTAALKDLLSRIDLDELMKKDEPPFDFPDTLEGFEYAFNEK
  GQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITRYVYELLESDCNLKKISIPVDATESEPKSFIFMS
  EDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMDEGYGVIVLNPNENYIEVEKQK
  MHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRNPQKEKEMMQLFIRENGSPEEHAVYVWDHFI
  AQAAAENVFFVAHSYGGLAFVELMIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSS
  SEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFAEASEAKSSSQKPALTRRSHRIKHEEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612185
• Locus ID: 68675
• UniProt ID: Q3TNH5
• Cytogenetics: 13 C1
• Refseq Size: 4036
• Refseq ORF: 1251
• Synonyms: 53-E6; 1110033M05Rik; 2610318O14Rik; 9430037D06Rik; AF064782; pEN87
• Summary: Plays a role in the regulation of alternative splicing, by interacting with AGO2 and CHD7. Seems to be required for stabilizing protein-protein interactions at the chromatin-spliceosome interface (PubMed:29311329). May have hydrolase activity (PubMed:29311329).[UniProtKB/Swiss-Prot Function]