Ddr1 (BC065998) Mouse Recombinant Protein

CAT#: TP510041

Purified recombinant protein of Mouse discoidin domain receptor family, member 1 (cDNA clone MGC:90037 IMAGE:5686085), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210041 representing BC065998
  Red=Cloning site Green=Tags(s)
  
  MGTGTLSSLLLLLLLVTIGDADMKGHFDPAKCRYALGMQDRTIPDSDISVSSSWSDSTAARHSRLESSDG
  DGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQE
  VISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMV
  HLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRGWPGYDYVGWSNQSFPTGYVEMEFEFDRLR
  TFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQC
  RFLFAGPWLLFSEISFISDVVNDSSDTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGC
  LVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPRGT
  PPHSAPCVPNGSACSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDG
  PPRVDFPRSRLRFKEKLGEGQFGEVHLCEVEDPAALSQWEPSRGSWTRKPEKPMAPHPTVSILAHSQEAV
  SLRVGWACPRSRYTHSLPFLPSICQVPPSQLALWLGSCLTSSSFLLVTHWTPPAEN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 94.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 12305
• UniProt ID: Q03146
• Cytogenetics: 17 18.7 cM
• Refseq Size: 2582
• Refseq ORF: 2058
• Synonyms: 6030432F18, CD167a, PTK3A
• Summary: Tyrosine kinase that functions as cell surface receptor for fibrillar collagen and regulates cell attachment to the extracellular matrix, remodeling of the extracellular matrix, cell migration, differentiation, survival and cell proliferation. Collagen binding triggers a signaling pathway that involves SRC and leads to the activation of MAP kinases. Regulates remodeling of the extracellular matrix by up-regulation of the matrix metalloproteinases MMP2, MMP7 and MMP9, and thereby facilitates cell migration and wound healing, but also tumor cell invasion. Promotes smooth muscle cell migration, and thereby contributes to arterial wound healing. Phosphorylates PTPN11 (By similarity). Required for normal blastocyst implantation during pregnancy, for normal mammary gland differentiation and normal lactation. Required for normal ear morphology and normal hearing.[UniProtKB/Swiss-Prot Function]