Ngly1 (NM_021504) Mouse Recombinant Protein

CAT#: TP509772

Purified recombinant protein of Mouse N-glycanase 1 (Ngly1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Ngly1"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209772 protein sequence
Red=Cloning site Green=Tags(s)

MASATLGSSSSSASPAVAELCQNTPETFLEASKLLLTYADNILRNPSDEKYRSIRIGNTAFSTRLLPVRG
AVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSSKKVQFSQHPAAAKLPLEQSEDPA
GLIRHSGNQTGQLPSLPSAPMVVGDSTILKVLQSNIQHVQLYENPVLQEKALTCIPVSELKRKAQEKLFR
ARKLDKGTNVSDEDFLLLELLHWFKEEFFRWVNNIVCSKCGGETRSRDEALLPNDDELKWGAKNVENHYC
DACQLSNRFPRYNNPEKLLETRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCD
ACEDVCDKPLLYEIGWGKKLSYIIAFSKDEVVDVTWRYSCKHDEVMSRRTKVKEELLRETINGLNKQRQL
SLSESRRKELLQRIIVELVEFISPKTPRPGELGGRVSGSLAWRVARGETGLERKEILFIPSENEKISKQF
HLRYDIVRDRYIRVSDNNINISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLK
VDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLF
RQSLNDSGENGLEIIITFNDL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 74.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067479
Locus ID 59007
UniProt ID Q9JI78
Cytogenetics 14 7.08 cM
Refseq Size 2901
Refseq ORF 1956
Synonyms 1110002C09Rik; Png1; PNGase
Summary Specifically deglycosylates the denatured form of N-linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation. Cleaves the beta-aspartyl-glucosamine (GlcNAc) of the glycan and the amide side chain of Asn, converting Asn to Asp. Prefers proteins containing high-mannose over those bearing complex type oligosaccharides. Can recognize misfolded proteins in the endoplasmic reticulum that are exported to the cytosol to be destroyed and deglycosylate them, while it has no activity toward native proteins. Deglycosylation is a prerequisite for subsequent proteasome-mediated degradation of some, but not all, misfolded glycoproteins.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.