Grhl2 (NM_026496) Mouse Recombinant Protein
CAT#: TP509534
Purified recombinant protein of Mouse grainyhead like transcription factor 2 (Grhl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Grhl2"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR209534 representing NM_026496
Red=Cloning site Green=Tags(s) MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGLLYDY YKVPRDKRLLSVSKASDSQEDQDKRNCLGTSEAQINLSGGENRVQVLKTVPVNLCLSQDHMENSKREQYS VSITESSAVIPVSGITVVKAEDFTPVFMAPPVHYPRADSEEQRVVIFEQTQYDLPSIASHSSYLKDDQRS TPDSTYSESFKDGASEKFRSTSVGADEYTYDQTGSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITL SETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEI AYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKG AERKIRDEERKQNRKKGKGQASQAQCNNSSDGKMAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANL QRTGQVYYNTDDEREGSSVLVKRMFRPMEEEFGPTPSKQIKEENVKRVLLYVRKENDDVFDALMLKSPTV KGLMEALSEKYGLPVEKITKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKITLMEI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 71.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080772 |
Locus ID | 252973 |
UniProt ID | Q8K5C0 |
Cytogenetics | 15 B3.1 |
Refseq Size | 4751 |
Refseq ORF | 1875 |
Synonyms | 0610015A08Rik; BOM; clft3; Tcfcp2l3 |
Summary | Transcription factor playing an important role in primary neurulation and in epithelial development. Binds directly to the consensus DNA sequence 5'-AACCGGTT-3' acting as an activator and repressor on distinct target genes (PubMed:22696678). During embryogenesis, plays unique and cooperative roles with GRHL3 in establishing distinct zones of primary neurulation. Essential for closure 3 (rostral end of the forebrain), functions cooperatively with GRHL3 in closure 2 (forebrain/midbrain boundary) and posterior neuropore closure (PubMed:20654612). Regulates epithelial morphogenesis acting as a target gene-associated transcriptional activator of apical junctional complex components. Up-regulates of CLDN3 and CLDN4, as well as of RAB25, which increases the CLDN4 protein and its localization at tight junctions (PubMed:22696678). Comprises an essential component of the transcriptional machinery that establishes appropriate expression levels of CLDN4 and CDH1 in different types of epithelia (PubMed:20978075). Exhibits functional redundancy with GRHL3 in epidermal morphogenetic events such as eyelid fusion and epidermal wound repair (PubMed:21081122). In lung, forms a regulatory loop with NKX2-1 that coordinates lung epithelial cell morphogenesis and differentiation (PubMed:22955271). In keratinocytes, plays a role in telomerase activation during cellular proliferation, regulates TERT expression by binding to TERT promoter region and inhibiting DNA methylation at the 5'-CpG island, possibly by interfering with DNMT1 enzyme activity. In addition, impairs keratinocyte differentiation and epidermal function by inhibiting the expression of genes clustered at the epidermal differentiation complex (EDC) as well as GRHL1 and GRHL3 through epigenetic mechanisms (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.