Lpp (NM_178665) Mouse Recombinant Protein

CAT#: TP509419

Purified recombinant protein of Mouse LIM domain containing preferred translocation partner in lipoma (Lpp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209419 representing NM_178665
  Red=Cloning site Green=Tags(s)
  
  MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKYAPVVAPKPKYNPYKQPGGEGDLLPP
  PPPPLEDPGTIPPGPGHFPPPPPLDEGAFKVQQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKP
  RPPQGSASSIASPPVSTPVTGHKRMVIPQQPPLTATKKSATKPQPAPQAAPIPVTPIGTLKPQPQPVPAS
  YTTASTSSRPTFNVQVKSAQPSPHYMAGPSSGQIYGPGPRGYNNQPVPVSGQCPPPPTCVGTDYAYIPPS
  GHPPESGYGYTSNQGRYYEPYYAAGPSYGGRSEGDTAYGQQVQPNTWKREAAYAPPASGNQNHPGMYPVS
  GPKKTYITDPVSAPCAPPLQPKGGYPGPMGPPSIPPSFRPEDELEHLTKKMLYDMENPPADDYFGRCARC
  GENVVGEGTGCTAMDQVFHVDCFTCIVCDVKLRGQPFYAVEKKAYCEPCYINTLEQCSVCSKPIMERILR
  ATGKAYHPHCFTCVMCHRSLDGIPFTVDACGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALD
  RDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 65.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848780
• Locus ID: 210126
• UniProt ID: Q8BFW7
• Cytogenetics: 16 B1
• Refseq Size: 15669
• Refseq ORF: 1839
• Synonyms: 9430020K16Rik; AA959454; AU024130; B130055L10Rik; C79715; D630048H16
• Summary: May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. Also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus (By similarity).[UniProtKB/Swiss-Prot Function]