Spata7 (NM_178914) Mouse Recombinant Protein

CAT#: TP509112

Purified recombinant protein of Mouse spermatogenesis associated 7 (Spata7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209112 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGSRRVRATSVLPRYSPPCLFTGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAIHYNKILSAKAAVDCSI
  PVSVNTSIKYADQQRREKLRKELARCEKEFKLSKSAMQTNSKMNSKFFVNSLQKPSGEPQDQDVFIEEMT
  RYPSFSKSLIPSSEGLHLSLPESSKMLMSGTQKHASTSPSRHSGCGHGCDRRPRSAHQFQVALAKTPSGD
  LLEKHSDLFSNKQSPFTPRTLKTEAKSFLSQYRYYTPAKRRKDFSDQRMEAETQTELSSFNSELGTAEKT
  SSKDSEVNINQVPNYTRNGAEDKIAPLPSQGQNLAWDSIQDGILQQSSERASCKLSTEFSPDSKIYSDEE
  ELLYLSFMENVTDEILKLGLFSNRFLERLFERHIKKNKHHLEEGKMRYLLHGLKVDLGCISEEDPAKQKH
  FRMLNQLHFQKALISRENEFVSDEETVSHHERQQYQEALDMLSAVPKDENKMFSLPGEFLIPAHKVKHSE
  GVIIQQVNDETDNEASPWNENNPSVSDSVIDQETSVDVIEGDSDFERAETSRELCCLSTSLSPSGPFPSI
  NGGSNHGKELSTLRIMGMSIED
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 65.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_849245
• Locus ID: 104871
• UniProt ID: Q80VP2, Q3U5D0
• Cytogenetics: 12 E
• Refseq Size: 2071
• Refseq ORF: 1749
• Synonyms: AI661438; B230306G18Rik; HSD3
• Summary: Involved in the maintenance of both rod and cone photoreceptor cells (PubMed:25398945, PubMed:29100828, PubMed:29899041). Required for photoreceptor-specific localization of proximal connecting cilium (CC) proteins RPGR, AHI1, NPHP1, NPHP4, and RPGRIP1 at the distal CC, a photoreceptor-specific extension of the primary cilium transition zone (PubMed:25398945, PubMed:29100828, PubMed:29899041). Maintenance of protein localization at the photoreceptor-specific distal CC is essential for normal microtubule stability and to prevent photoreceptor degeneration (PubMed:25398945, PubMed:29899041).[UniProtKB/Swiss-Prot Function]