Nprl3 (NM_181569) Mouse Recombinant Protein

CAT#: TP508964

Purified recombinant protein of Mouse nitrogen permease regulator-like 3 (Nprl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208964 representing NM_181569
  Red=Cloning site Green=Tags(s)
  
  MGDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSRYAVNNTGEHADDQDGDSRFSDVILA
  TILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQVSKTDPSPKREAPTMILFNVVFALRANADPSVIN
  CLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADANEGPQSPFQHILPKCKLARDLKEAYDS
  LCTSGVVRLHINSWLEVSFCLPHKIHYAASSLIPPEAIERSLKAIRPYHALLLLSDEKSLLSELPIDCSP
  ALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAVIIYPLCENNVYVMSPNASVCLYSPLAE
  QFSRQFPSHDLPSVLAKFSLPVSLSEFRSPLAPPAQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSEEE
  PRLREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLNKRMTENLLASL
  SEHERAAILNVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPV
  IAVFQALLT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 63.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_853547
• Locus ID: 17168
• UniProt ID: Q8VIJ8
• Cytogenetics: 11 18.83 cM
• Refseq Size: 2865
• Refseq ORF: 1707
• Synonyms: Aag; CGTHBA; HS-26; HS-40; m(alpha)RE; Mare; Phg; Prox1
• Summary: As a component of the GATOR1 complex functions as an inhibitor of the amino acid-sensing branch of the TORC1 pathway. The GATOR1 complex strongly increases GTP hydrolysis by RRAGA and RRAGB within RRAGC-containing heterodimers, thereby deactivating RRAGs, releasing mTORC1 from lysosomal surface and inhibiting mTORC1 signaling. The GATOR1 complex is negatively regulated by GATOR2 the other GATOR subcomplex in this amino acid-sensing branch of the TORC1 pathway.[UniProtKB/Swiss-Prot Function]