Igf2bp2 (NM_183029) Mouse Recombinant Protein

CAT#: TP508687

Purified recombinant protein of Mouse insulin-like growth factor 2 mRNA binding protein 2 (Igf2bp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Igf2bp2"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208687 representing NM_183029
Red=Cloning site Green=Tags(s)

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIME
VDYSVSKKLRSRRIQIRNIPPHLQWEVLDGLLAEYGTVENVEQVNTDTETAVVNVTYMTREEAKLAIEKL
SGHQFEDYSFKISYIPDEEVSSPSPPHRAREQGHGPGSSSQARQIDFPLRILVPTQFVGAIIGKEGLTIK
NITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEVPLKILAHNGFVG
RLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVRGTIEACANAEIEIMKKLREAFENDMLAVN
QQANLIPGLNLSALGIFSTGLSVLPPPAGPRGVPPSPPYHPFATHSGYFSSLYPHHHFGPFPHHHSYPEQ
ETVSLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLK
EENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFA
SQTAQRKIREIVQQVKQQEQRYPQGVAPQRSK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 66 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_898850
Locus ID 319765
UniProt ID Q5SF07
Cytogenetics 16 B1
Refseq Size 3902
Refseq ORF 1776
Synonyms C330012H03Rik; IMP-2; Imp2; Neilsen
Summary RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation (By similarity). Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. Binds to beta-actin/ACTB and MYC transcripts (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.