Galnt2 (BC053063) Mouse Recombinant Protein

CAT#: TP508588

Purified recombinant protein of Mouse UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (cDNA clone MGC:62366, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208588 representing BC053063
  Red=Cloning site Green=Tags(s)
  
  MALHNPQGDWNDIDSIKKKDLHHSRGDEKAQGVETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFN
  QVESDKLHMDRGIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKRSPPHLIKEIILVD
  DYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNERWLEPLLERVAEDR
  TRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDK
  LYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAA
  EVWMDEYKHFYYAAVPSARNVPYGNIQSRLELRKKLGCKPFKWYLDNVYPELRVPDHQDIAFGALQQGTN
  CLDTLGHFADGVVGIYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRSPGSLIRLQGCRENDSRQKWEQI
  EGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFSLNLQQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 145.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 108148
• UniProt ID: Q6PB93
• Cytogenetics: 8 E2
• Refseq Size: 3975
• Refseq ORF: 1608
• Synonyms: AI480629
• Summary: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region (By similarity).[UniProtKB/Swiss-Prot Function]