Ubap1 (NM_023305) Mouse Recombinant Protein

CAT#: TP508065

Purified recombinant protein of Mouse ubiquitin-associated protein 1 (Ubap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208065 representing NM_023305
  Red=Cloning site Green=Tags(s)
  
  MASKKLGTDVHGTFSYLDDVPFKIGDKFKTPAKVGLPIGFSLPDCLQVVREMQYDFSLEKKTIEWAEDIK
  LIQEAQREAERKAEEAEAKVNSKSGPEGDSKVSFPKTHNTATMPPPINPILASLQHNNILTPTRVSSSAT
  KQKVLSPPHTKADFNPADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDSNTARGSSGAVLQ
  DEEVLASLEQATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPTVSNIKSLSFPKLDSDDSNQKT
  VKLASTFHSTSCLRSGASRSLLKPSTQSSASELNGDHTLGLSALNLNSGTEVPTLTSSQMPSLSSVSVCT
  EESSPPDPCPTVTPLNFSVSQVPNMPSCPQAYLELQALSPSERQCVETVVNMGYSYDCVLRAMRKKGENI
  EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN
  ALEDLMARAGAS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 55 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075794
• Locus ID: 67123
• UniProt ID: Q8BH48
• Cytogenetics: 4 A5
• Refseq Size: 2716
• Refseq ORF: 1506
• Synonyms: 2700092A01Rik; NAG20; Ubap; UBAP-1
• Summary: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Plays a role in the proteasomal degradation of ubiquitinated cell-surface proteins, such as EGFR and BST2 (By similarity).[UniProtKB/Swiss-Prot Function]