Nup50 (NM_016714) Mouse Recombinant Protein

CAT#: TP507453

Purified recombinant protein of Mouse nucleoporin 50 (Nup50), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKRVAEKELTDRNWDEEDEVEEMGTFSVASEEVMKNRAVKKAKRRNVGFESDSGGAFKGFKGLVVPSGG
  GGFSGFGGSGGKPLEGLTNGNSTDNATPFSNVKTAAEPKAAFGSFAVNGPTTLVDKKISSPKCNNSNQPP
  SSGPASSTACPGNAYHKQLAGLNCSVRDWIVKHVNTNPLCDLTPIFKDYERYLATIEKQLENGGGSSSES
  QTDRATAGMEPPSLFGSTKLQQESPFSFHGNKAEDTSEKVEFTAEKKSDAAQGATSASFSFGKKIESSAL
  GSLSSGSLTGFSFSAGSSSLFGKDAAQSKAASSLFSAKASESPAGGGSSECRDGEEEENDEPPKVVVTEV
  KEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKN
  NVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADELHKILLEKKDA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 49.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057923
• Locus ID: 18141
• UniProt ID: Q9JIH2
• Cytogenetics: 15 40.25 cM
• Refseq Size: 4766
• Refseq ORF: 1401
• Synonyms: 1700030K07Rik; AI413123; Npap60
• Summary: Component of the nuclear pore complex that has a direct role in nuclear protein import (PubMed:10811608). Actively displaces NLSs from importin-alpha, and facilitates disassembly of the importin-alpha:beta-cargo complex and importin recycling (PubMed:16222336). Interacts with regulatory proteins of cell cycle progression including CDKN1B (PubMed:10891500, PubMed:10811608). This interaction is required for correct intracellular transport and degradation of CDKN1B (PubMed:10811608).[UniProtKB/Swiss-Prot Function]