Mark3 (BC026445) Mouse Recombinant Protein

CAT#: TP506826

Purified recombinant protein of Mouse MAP/microtubule affinity-regulating kinase 3 (cDNA clone MGC:31426 IMAGE:4459439), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206826 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGRKSAEL
  DASDSSSSSNLSLAKVRPNSDLSNSTGQSPHHKGQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTA
  DSDLKEDGIPSRKSSSSAVGGKGIAPASPMLGNAGNPNKADIPERKKSPAVPSSNTASGGMTRRNTYVCS
  ERCAADRHSVIQNGKENSAIPDERTPVASTHSISSATTPDRIRFPRGTASRSTFHGQPRERRTATYNGPP
  ASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSSEQKDENREAKPRSLRFTWSMKTTSSMDPSDM
  MREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIAS
  KIANELKL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 17169
• UniProt ID: Q03141
• Cytogenetics: 12 F1
• Refseq Size: 1865
• Refseq ORF: 1284
• Synonyms: ETK-1, Emk2
• Summary: Serine/threonine-protein kinase. Involved in the specific phosphorylation of microtubule-associated proteins for MAPT/TAU, MAP2 and MAP4. Phosphorylates CDC25C. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus. Negatively regulates the Hippo signaling pathway and antagonizes the phosphorylation of LATS1. Cooperates with DLG5 to inhibit the kinase activity of STK3/MST2 toward LATS1.[UniProtKB/Swiss-Prot Function]