Mmaa (NM_133823) Mouse Recombinant Protein

CAT#: TP506557

Purified recombinant protein of Mouse methylmalonic aciduria (cobalamin deficiency) type A (Mmaa), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTISTLLLSPNRRLLTCLSRVPSPWLLHSSPPAPGPPGALPNCFGHHCTKRVLLSDGFRRTLCVQATLKD
  HTEGLSDKEQRFVDRLYTGLVKGQRACLAEAITLVESTHTRKRELAQVLLQRVLALQREQELRNQGKPLT
  FRVGLSGPPGAGKSTFIECFGKMLTEQGHRLSVLAVDPSSCTSGGSLLGDKTRMIELSRDMNAYIRPSPT
  SGTLGGVTRTTNEAIVLCEGGGYDIILIETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMA
  DLVVITKSDGDLIVPARRIQAEYVSALKLLRRRSEVWRPKVIRISARSGEGITEMWDTMREFQHQMLASG
  ELAAKRQTQHKVWMWNLIQENVLEHFKTHPSIREQIPLMERKVLSGALSPGRAADLLLKAFKSRH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 45.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598584
• Locus ID: 109136
• UniProt ID: Q8C7H1
• Cytogenetics: 8 C1
• Refseq Size: 2843
• Refseq ORF: 1248
• Synonyms: 2810018E08Rik; AI840684
• Summary: GTPase, binds and hydrolyzes GTP. Involved in intracellular vitamin B12 metabolism, mediates the transport of cobalamin (Cbl) into mitochondria for the final steps of adenosylcobalamin (AdoCbl) synthesis. Functions as a G-protein chaperone that assists AdoCbl cofactor delivery from MMAB to the methylmalonyl-CoA mutase (MMUT) and reactivation of the enzyme during catalysis.[UniProtKB/Swiss-Prot Function]