Casq1 (NM_009813) Mouse Recombinant Protein

CAT#: TP506274

Purified recombinant protein of Mouse calsequestrin 1 (Casq1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206274 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGARAVSELRLALLFVLVLGTPRLGVQGEDGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPE
  DDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSA
  DTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHYKAYEDAAEEFHPYIPFFATFDS
  KVAKKLTLKLNEIDFYEAFMEEPMTIPDKPNSEEEIVSFVEEHRISTLRKLKPESMYETWEDDLDGIHIV
  AFAEEADPDGYEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADS
  IWMEMDNEEDLPSADELEDWLEDVLEGEINTEDDDDDDDDDDDDDDDDD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 45.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033943
• Locus ID: 12372
• UniProt ID: O09165, Q6P3C3, Q8C7M8
• Cytogenetics: 1 79.54 cM
• Refseq Size: 1874
• Refseq ORF: 1200
• Synonyms: CSQ; CSQ-1; CSQ1; sCSQ
• Summary: Calsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. Calcium ions are bound by clusters of acidic residues at the protein surface, often at the interface between subunits. Can bind around 80 Ca(2+) ions (By similarity). Regulates the release of lumenal Ca(2+) via the calcium release channel RYR1; this plays an important role in triggering muscle contraction. Negatively regulates store-operated Ca(2+) entry (SOCE) activity (By similarity).[UniProtKB/Swiss-Prot Function]