Barhl2 (NM_001005477) Mouse Recombinant Protein

CAT#: TP505994

Purified recombinant protein of Mouse BarH like homeobox 2 (Barhl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Barhl2"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205994 protein sequence
Red=Cloning site Green=Tags(s)

MTAMEGASGSSFGIDTILSGAGSGSPGMMNGDFRSLGEARTTDFRSQATPSPCSEIDTVGTAPSSPISVT
LEPPEPHLVTDGPQHHHHLHHSQQPPPPSAVPAQSLQPSPQQQPPPQPQSAAQQLGSAAAAPRTSTSSFL
IKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAAHESFRPKLEQEDGKTKLDKREDPQSDIKCHGTKEE
GDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNR
RTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQ
RPLVPRVLIHGLGPGGQPALNPLSNPIPGTPHPR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001005477
Locus ID 104382
UniProt ID Q8VIB5, Q7TNS3
Cytogenetics 5 E5
Refseq Size 2329
Refseq ORF 1155
Synonyms E130309B19Rik; MBH1
Summary Potential regulator of neural basic helix-loop-helix genes. It may down-regulate expression of ASCL1 and, within the thalamus, up-regulate NGN2, thereby regulating distinct patterns of neuronal differentiation (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.