Slc30a7 (NM_023214) Mouse Recombinant Protein

CAT#: TP505895

Purified recombinant protein of Mouse solute carrier family 30 (zinc transporter), member 7 (Slc30a7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205895 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH
  MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER
  LLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFNGALDHSHGHEDHCHSHEAKHGAAHSHDHDH
  AHGHGHLHSHDGPSFKATAGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILI
  VVSVIPLLRESVGILMQRTPPSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADA
  RWILSQTHNIFTQAGVRQLYVQIDFAAM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 41.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075703
• Locus ID: 66500
• UniProt ID: Q9JKN1
• Cytogenetics: 3 G1
• Refseq Size: 9020
• Refseq ORF: 1137
• Synonyms: 1810059J10Rik; 2610034N15Rik; 4833428C12Rik; AI467242; ZnT-7; ZnT7; Zntl2
• Summary: Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP (By similarity).[UniProtKB/Swiss-Prot Function]