Serpinb5 (NM_009257) Mouse Recombinant Protein

CAT#: TP505822

Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade B, member 5 (Serpinb5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205822 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDALRLANSAFAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHFENVKDVPFGF
  QTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVDFKDKLEETKGQINSSIKELT
  DGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRISKTDTKPVQMMNLEATFCLGNID
  DISCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEQQLNPETLLQWTNPSTMANAKVKLSLPKFKVEK
  MIDPKASLESLGLKSLFNESTSDFSGMSETKGVSLSNVIHRVCLEITEDGGESIEVPGSRILQHKDEFNA
  DHPFIYIIRHNKTRNIIFFGKFCSP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033283
• Locus ID: 20724
• UniProt ID: P70124
• Cytogenetics: 1 E2.1
• Refseq Size: 2565
• Refseq ORF: 1128
• Synonyms: 1110036M19Rik; AI462524; AI646751; Maspin; ovalbumin; PI-5; Spi7
• Summary: Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity (By similarity).[UniProtKB/Swiss-Prot Function]