Adh7 (NM_009626) Mouse Recombinant Protein

CAT#: TP505805

Purified recombinant protein of Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205805 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTAGKVIKCKAAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATGICRTDDHIIKGSMVSKFPVIVGHEA
  VGVVESVGEGVTTVRPGDKVIPLFLPQCRECNACLNPEGNLCIRSDLTGRGVLADGTTRFTCKGKPVQHF
  MNTSTFTEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGYGAAVKTAKVTPGSTCVVFGLGGVGLSVIMG
  CKAAGASRIIGIDINKDKFQKALAVGATECISPKDSTKPISEVLSDMTGNTIQYTFEVIGRLETMVDALS
  SCHMNYGTSVVVGAPPSAKMLTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL
  PFNNINEGFELLYSGKSIRTVLTF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033756
• Locus ID: 11529
• UniProt ID: Q64437, Q9D748
• Cytogenetics: 3 64.13 cM
• Refseq Size: 2079
• Refseq ORF: 1125
• Synonyms: Adh-3; Adh-3e; Adh-3t; Adh3; Adh3-e; Adh3-t; Adh4; Adt-1; AI325182
• Summary: Could function in retinol oxidation for the synthesis of retinoic acid, a hormone important for cellular differentiation.[UniProtKB/Swiss-Prot Function]