Lman2 (NM_025828) Mouse Recombinant Protein

CAT#: TP505476

Purified recombinant protein of Mouse lectin, mannose-binding 2 (Lman2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205476 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEAWLWRWGWGWGQRCPGRPGLPGPGPSPTTFLHLLLLLGPVAADITDGNSEHLKREHSLIKPYQGVG
  SSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYT
  RDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWSELAGCTADFRN
  RDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISIKLFQLTV
  ERTPEEESIDWTKIEPGVNFLKSPKDNVDDPTGNFRNGPLTGWRVFLLLLCALLGVVVCAVVGAVVFQKR
  QERNKRFY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080104
• Locus ID: 66890
• UniProt ID: Q9DBH5
• Cytogenetics: 13 B1
• Refseq Size: 4315
• Refseq ORF: 1077
• Synonyms: 1110003H06Rik; 1300009F09Rik; AA408240; AL023023; AU040819; GP36B; VIP36
• Summary: Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans (By similarity).[UniProtKB/Swiss-Prot Function]