Rfc3 (NM_027009) Mouse Recombinant Protein

CAT#: TP505432

Purified recombinant protein of Mouse replication factor C (activator 1) 3 (Rfc3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205432 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLWVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGIGVEKLRIE
  HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQRDFKVVLLTEVDKL
  TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICSVLSTVCRKEGLALPST
  LARRLAEKSCRNLRKALLMCEACRVQQYPFTEDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE
  LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG
  LEGMMF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081285
• Locus ID: 69263
• UniProt ID: Q8R323, Q3TKD1
• Cytogenetics: 5 G3
• Refseq Size: 1215
• Refseq ORF: 1071
• Synonyms: 38kDa; 2810416I22Rik; AU022547; Recc3
• Summary: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.[UniProtKB/Swiss-Prot Function]