Irf2 (NM_008391) Mouse Recombinant Protein
CAT#: TP505275
Purified recombinant protein of Mouse interferon regulatory factor 2 (Irf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Frequently bought together (1)
Other products for "Irf2"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205275 representing NM_008391
Red=Cloning site Green=Tags(s) MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGID KPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEERVKHIKQEP VESSLGLSNGVSGFSPEYAVLTSAIKNEVDSTVNIIVVGQSHLDSNIEDQEIVTNPPDICQVVEVTTESD DQPVSMSELYPLQISPVSSYAESETTDSVASDEENAEGRPHWRKRSIEGKQYLSNMGTRNTYLLPSMATF VTSNKPDLQVTIKEDSCPMPYNSSWPPFTDLPLPAPVTPTPSSSRPDRETRASVIKKTSDITQARVKSC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032417 |
Locus ID | 16363 |
UniProt ID | P23906, Q3U2Z2 |
Cytogenetics | 8 B1.1 |
Refseq Size | 2484 |
Refseq ORF | 1047 |
Synonyms | 9830146E22Rik; AI646973; Irf-2 |
Summary | Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.