Efnb1 (NM_010110) Mouse Recombinant Protein

CAT#: TP505205

Purified recombinant protein of Mouse ephrin B1 (Efnb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Efnb1"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205205 protein sequence
Red=Cloning site Green=Tags(s)

MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAG
RPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNG
SLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHET
VNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALS
LSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034240
Locus ID 13641
UniProt ID P52795, Q544L9
Cytogenetics X 43.22 cM
Refseq Size 3258
Refseq ORF 1038
Synonyms Cek5-; Cek5-L; EFL-; EFL-3; Elk; Elk-L; Ep; Epl; Epl2; Eplg2; Ler; LERK; LERK-2; Lerk2; St; Stra1
Summary This gene encodes a membrane protein that acts as a ligand for Eph family receptors. Signalling occurs bidirectionally in both the cell containing the receptor and the cell expressing this protein. Activity of this protein is important in neuronal axon growth and other developmental processes. [provided by RefSeq, May 2015]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.