Epcam (NM_008532) Mouse Recombinant Protein

CAT#: TP504481

Purified recombinant protein of Mouse epithelial cell adhesion molecule (Epcam), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGPQALAFGLLLAVVTATLAAAQRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMK
  AEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVR
  TYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIA
  DVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVSLAV
  IAGIVVLVISTRKKSAKYEKAEIKEMGEIHRELNA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032558
• Locus ID: 17075
• UniProt ID: Q99JW5
• Cytogenetics: 17 E4
• Refseq Size: 2061
• Refseq ORF: 948
• Synonyms: CD326; EGP; EGP-2; Egp314; Ep-CAM; EpCAM1; GA733-2; gp40; Ly74; Tacsd1; Tacstd1; TROP1
• Summary: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E (By similarity).[UniProtKB/Swiss-Prot Function]