Nhej1 (NM_029342) Mouse Recombinant Protein
CAT#: TP504061
Purified recombinant protein of Mouse non-homologous end joining factor 1 (Nhej1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Nhej1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204061 protein sequence
Red=Cloning site Green=Tags(s) MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA ALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGLILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLM GVSLALQSHVRELAALLRMKDLEIQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEACAVGDGKPF AMSLQSLYVAVTKQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRA QLVKSKRKKPRGLFS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083618 |
Locus ID | 75570 |
UniProt ID | Q3KNJ2 |
Cytogenetics | 1 C4 |
Refseq Size | 1415 |
Refseq ORF | 888 |
Synonyms | 1700029B21Rik; cernunnos; XLF |
Summary | DNA repair protein involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. May serve as a bridge between XRCC4 and the other NHEJ factors located at DNA ends, or may participate in reconfiguration of the end bound NHEJ factors to allow XRCC4 access to the DNA termini. It may act in concert with XRCC6/XRCC5 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are noncomplementary or partially complementary (PubMed:17360556). Binds DNA in a length-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.