Ybx3 (NM_011733) Mouse Recombinant Protein
CAT#: TP504006
Purified recombinant protein of Mouse Y box protein 3 (Ybx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Frequently bought together (1)
Other products for "Ybx3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204006 representing NM_011733
Red=Cloning site Green=Tags(s) MSEAGEATTGGTTLPQAAADAPAAAPPDPAPKSPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAG GEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEG EKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNAGEIGEMKDGVPEGTQLQAHRNPTYRP RFRRGPARPRPAPAIGEAEDKENQQAANGPNQPSARRGFRRPYNYRRRSRPLNAVSQDGKETKAGEAPTE NPAPATEQSSAE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035863 |
Locus ID | 56449 |
UniProt ID | Q9JKB3, Q68G78 |
Cytogenetics | 6 F3 |
Refseq Size | 1655 |
Refseq ORF | 876 |
Synonyms | Csda; dbpA; Dpba; MSY3; MSY4; oxyR; Yb2 |
Summary | Binds to the GM-CSF promoter. Seems to act as a repressor (By similarity). Binds also to full-length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.