Ybx3 (NM_011733) Mouse Recombinant Protein

CAT#: TP504006

Purified recombinant protein of Mouse Y box protein 3 (Ybx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204006 representing NM_011733
  Red=Cloning site Green=Tags(s)
  
  MSEAGEATTGGTTLPQAAADAPAAAPPDPAPKSPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAG
  GEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEG
  EKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNAGEIGEMKDGVPEGTQLQAHRNPTYRP
  RFRRGPARPRPAPAIGEAEDKENQQAANGPNQPSARRGFRRPYNYRRRSRPLNAVSQDGKETKAGEAPTE
  NPAPATEQSSAE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035863
• Locus ID: 56449
• UniProt ID: Q9JKB3, Q68G78
• Cytogenetics: 6 F3
• Refseq Size: 1655
• Refseq ORF: 876
• Synonyms: Csda; dbpA; Dpba; MSY3; MSY4; oxyR; Yb2
• Summary: Binds to the GM-CSF promoter. Seems to act as a repressor (By similarity). Binds also to full-length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression.[UniProtKB/Swiss-Prot Function]