Uck2 (NM_030724) Mouse Recombinant Protein

CAT#: TP503431

Purified recombinant protein of Mouse uridine-cytidine kinase 2 (Uck2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203431 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTS
  EQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADVVLFEGILAF
  YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
  GADNLVAINLIVQHIQDILNGGLSKRQTNGYLNGYTPSRKRQASESSSRPH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_109649
• Locus ID: 80914
• UniProt ID: Q99PM9, Q543C2
• Cytogenetics: 1 H2.3
• Refseq Size: 1338
• Refseq ORF: 786
• Synonyms: AA407809; AI481316; AU018180; AU020720; TSA903; UK; UMK; Umpk
• Summary: Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine (By similarity).[UniProtKB/Swiss-Prot Function]