Psme3 (NM_011192) Mouse Recombinant Protein

CAT#: TP503255

Purified recombinant protein of Mouse proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (Psme3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI
  LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV
  QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEID
  EKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035322
• Locus ID: 19192
• UniProt ID: P61290, Q4FK54
• Cytogenetics: 11 64.67 cM
• Refseq Size: 2620
• Refseq ORF: 765
• Synonyms: AA410043; AU020960; Ki; pa28g; PA28gamma; REGgamma
• Summary: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition (By similarity).[UniProtKB/Swiss-Prot Function]