Commd5 (NM_025536) Mouse Recombinant Protein

CAT#: TP502621

Purified recombinant protein of Mouse COMM domain containing 5 (Commd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202621 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSALGAPAPYLHHPTDSHSGRVSFLGSQPSAEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVQH
  LGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDS
  VAQQQGSSLPRVSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKE
  MAELERKCERKLQD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079812
• Locus ID: 66398
• UniProt ID: Q8R395, A0A0R4J0U7
• Cytogenetics: 15 36.28 cM
• Refseq Size: 998
• Refseq ORF: 675
• Synonyms: 2310065H03Rik; AI854466; D15Ertd81e; Hcarg
• Summary: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis. Down-regulates activation of NF-kappa-B.[UniProtKB/Swiss-Prot Function]