Fkbp3 (NM_013902) Mouse Recombinant Protein

CAT#: TP502616

Purified recombinant protein of Mouse FK506 binding protein 3 (Fkbp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Fkbp3 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202616 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLVNAYNHLFESK
  RFKGTETISKVSEQVKNVKLSDDKPKDSKSEETLDEGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLP
  DGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP
  NTKLIFEVELVDID
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038930
• Locus ID: 30795
• UniProt ID: Q62446, Q3UBU9
• Cytogenetics: 12 C1
• Refseq Size: 945
• Refseq ORF: 675
• Synonyms: 25kDa; FKBP-3; FKBP25
• Summary: FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins (By similarity).[UniProtKB/Swiss-Prot Function]