Edn1 (NM_010104) Mouse Recombinant Protein
CAT#: TP502095
Purified recombinant protein of Mouse endothelin 1 (Edn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Frequently bought together (1)
Other products for "Edn1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202095 protein sequence
Red=Cloning site Green=Tags(s) MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMDKECVYFCHLD IIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKCWNFCQAGKELRAQSTMQKSL KDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKASFRVAKLKAELYRDQKLTHNRAH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034234 |
Locus ID | 13614 |
UniProt ID | P22387, Q544E0 |
Cytogenetics | 13 20.82 cM |
Refseq Size | 2344 |
Refseq ORF | 609 |
Synonyms | ET-1; PPET1; preproET |
Summary | This gene encodes a member of the endothelin family of peptides. The encoded preproprotein undergoes proteolytic processing to generate a peptide before secretion by the vascular endothelial cells. The mature peptide has various biological activities such as vasoconstriction, cell proliferation, stimulation of hormone release and modulation of central nervous activity. Mice lacking the encoded protein exhibit neonatal lethality accompanied with numerous craniofacial and cardiovascular defects due to disruption in cranial and cardiac neural crest cell patterning during early embryogenesis. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.