Prdx2 (NM_011563) Mouse Recombinant Protein

CAT#: TP501968

Purified recombinant protein of Mouse peroxiredoxin 2 (Prdx2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201968 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC
  EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVIKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQ
  ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035693
• Locus ID: 21672
• UniProt ID: Q61171
• Cytogenetics: 8 41.4 cM
• Refseq Size: 942
• Refseq ORF: 597
• Synonyms: AL022839; Band-8; NkefB; PRP; PrxII; Tdpx1; TDX1; Torin; TPx; TPx-B; TR; TSA
• Summary: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).[UniProtKB/Swiss-Prot Function]