Cmtm6 (NM_026036) Mouse Recombinant Protein
CAT#: TP501673
Purified recombinant protein of Mouse CKLF-like MARVEL transmembrane domain containing 6 (Cmtm6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Frequently bought together (1)
Other products for "Cmtm6"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201673 protein sequence
Red=Cloning site Green=Tags(s) MENGAVYSPTTEAAPGTGRGARSGLAAYFVLGRLPWHRRILKGLQLLLSLLAFICEEVVSECGLCGGLYF FEFVSCSAFLLSLLLLIVYCTPVHDRVDTGKVKSSDFYITLGTGCVFLLASIIFVSTHSGTSAEIAAIVF GFLASSMFLLDFVVMLCEKLRESPLRKPENNAKVEALTEPLNA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080312 |
Locus ID | 67213 |
UniProt ID | Q9CZ69 |
Cytogenetics | 9 F3 |
Refseq Size | 3352 |
Refseq ORF | 552 |
Synonyms | 2810051A14Rik; AA536733; Cklfsf6 |
Summary | Master regulator of recycling and plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. Associates with both constitutive and IFNG-induced PD-L1/CD274 at recycling endosomes, where it protects PD-L1/CD274 from being targeted for lysosomal degradation, likely by preventing its ubiquitination. May stabilize PD-L1/CD274 expression on antigen presenting cells and potentiates inhibitory signaling by PDCD1/CD279, its receptor on T-cells, ultimately triggering T-cell anergy.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.