Ccdc115 (NM_027159) Mouse Recombinant Protein

CAT#: TP501615

Purified recombinant protein of Mouse coiled-coil domain containing 115 (Ccdc115), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVQALREELDSKCLQLLSDLEELEAKRAALNARVEEGWLSLAKARYAMGAKSVGPLQYASRMEPQVCVR
  ASEAQDGPQTFRVIKADAQTPEEVGPSEASLRRRKGPTKTKELGSAVVPQDPLNWFGILVPHSLRQAQAS
  FRDGLQLAADIASLQTRINWGQSQLRGLQKKLKELDPGPA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081435
• Locus ID: 69668
• UniProt ID: Q8VE99
• Cytogenetics: 1 B
• Refseq Size: 1721
• Refseq ORF: 543
• Synonyms: 2310061I09Rik; Ccp1
• Summary: Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation (By similarity). May be involved in Golgi homeostasis (By similarity).[UniProtKB/Swiss-Prot Function]