Bcl2l2 (BC040369) Mouse Recombinant Protein

CAT#: TP501573

Purified recombinant protein of Mouse Bcl2-like 2 (cDNA clone MGC:25286 IMAGE:4511215), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201573 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV
  TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHS
  SGGWVRSSQLLLSASLYKVGLHGKIGPLMGGWGCAGKG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 12050
• UniProt ID: P70345
• Cytogenetics: 14 27.98 cM
• Refseq Size: 3815
• Refseq ORF: 534
• Synonyms: bcl-w, bclw
• Summary: Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.[UniProtKB/Swiss-Prot Function]