Siva1 (NM_013929) Mouse Recombinant Protein

CAT#: TP501528

Purified recombinant protein of Mouse SIVA1, apoptosis-inducing factor (Siva1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201528 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKRSCPFADAAPLQLKVHVGLKELSHGVFAERYSREVFERTKQLLFQGARAYRDHISSEDCSVNHLQES
  LKSGVVGAPQPARGQMLIGPDGRLTRCQAQASEGGLPRTAPIACSSCMRSVDGKAACSQCERALCGQCVY
  TCWGCGALACVLCGLADYADDGEKTLCTSCAMFEA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 18.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038957
• Locus ID: 30954
• UniProt ID: O54926
• Cytogenetics: 12 F1
• Refseq Size: 782
• Refseq ORF: 528
• Synonyms: CD27bp; Siva
• Summary: Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis (By similarity).[UniProtKB/Swiss-Prot Function]