Ppdpf (NM_025598) Mouse Recombinant Protein

CAT#: TP500479

Purified recombinant protein of Mouse pancreatic progenitor cell differentiation and proliferation factor (Ppdpf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200479 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPGLPKADPGHWWASFFFGKSTLPFMTT
  VLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPRDLS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 12.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079874
• Locus ID: 66496
• UniProt ID: Q9CR37
• Cytogenetics: 2 H4
• Refseq Size: 797
• Refseq ORF: 348
• Synonyms: 0610012G23Rik; 2610317A05Rik; 2700038C09Rik; 3110053G12Rik
• Summary: Probable regulator of exocrine pancreas development.[UniProtKB/Swiss-Prot Function]