Dpm2 (NM_010073) Mouse Recombinant Protein

CAT#: TP500175

Purified recombinant protein of Mouse dolichol-phosphate (beta-D) mannosyltransferase 2 (Dpm2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200175 representing NM_010073
  Red=Cloning site Green=Tags(s)
  
  MATGTDQAVGFGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVLLPLAAGLLLLLFVGLFIT
  YVMLKSQKITKKAQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 9.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034203
• Locus ID: 13481
• UniProt ID: Q9Z324, Q545R7
• Cytogenetics: 2 B
• Refseq Size: 877
• Refseq ORF: 252
• Synonyms: AW557993; R75484
• Summary: Regulates the biosynthesis of dolichol phosphate-mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. When associated with the GPI-GlcNAc transferase (GPI-GnT) complex enhances but is not essential for its activity (By similarity).[UniProtKB/Swiss-Prot Function]