Sohlh2 (CCDC169-SOHLH2) (NM_001198910) Human Recombinant Protein

CAT#: TP331278L

Recombinant protein of human C13orf38-SOHLH2 readthrough (C13orf38-SOHLH2), 1 mg

Product Images

Coomassie blue staining of purified CCDC169-SOHLH2 protein (Cat# TP331278). The protein was produced from HEK293T cells transfected with CCDC169-SOHLH2 cDNA clone (Cat# RC231278) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC231278 representing NM_001198910
  Red=Cloning site Green=Tags(s)
  
  METLQESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVD
  QLPRMQENLVKTLLLKEELDPLKAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDC
  IFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVV
  KYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKIS
  LLHSSKEKLRRERIKYCCEQLRTLLPYVKGRKNDAASVLEATVDYVKYIREKISPAVMAQITEALQSNMR
  FCKKQQTPIELSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSASENA
  IGDPYKTHISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRHCTSGLGQTCT
  THPNCLQQFWAY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 56.6
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001185839
• Locus ID: 100526761
• UniProt ID: Q9NX45
• Cytogenetics: 13q13.3
• Refseq ORF: 1506
• Synonyms: C13orf38-SOHLH2; SOHLH2; TEB1
• Summary: This locus represents naturally occurring read-through transcription between the neighboring C13orf38 (chromosome 13 open reading frame 38) and SOHLH2 (spermatogenesis and oogenesis specific basic helix-loop-helix 2) genes. The read-through transcript encodes a fusion protein that shares sequence identity with the products of each individual gene. [provided by RefSeq, Nov 2010]