CHFR (NM_001161344) Human Recombinant Protein
CAT#: TP328526
Recombinant protein of human checkpoint with forkhead and ring finger domains (CHFR), transcript variant 1, 20 µg
View other "CHFR" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228526 representing NM_001161344
Red=Cloning site Green=Tags(s) MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSG QVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSEKQGMTQESFEANKEN VFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGG GGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRN AQTVHEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERIC KNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQ PMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDIL KNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVT SRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 73.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001154816 |
Locus ID | 55743 |
UniProt ID | Q96EP1 |
Cytogenetics | 12q24.33 |
Refseq ORF | 1992 |
Synonyms | RNF116; RNF196 |
Summary | This gene encodes an E3 ubiquitin-protein ligase required for the maintenance of the antephase checkpoint that regulates cell cycle entry into mitosis and, therefore, may play a key role in cell cycle progression and tumorigenesis. The encoded protein has an N-terminal forkhead-associated domain, a central RING-finger domain, and a cysteine-rich C-terminal region. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Mar 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413203 | CHFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC431493 | CHFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431554 | CHFR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413203 | Transient overexpression lysate of checkpoint with forkhead and ring finger domains (CHFR), transcript variant 4 |
USD 665.00 |
|
LY431493 | Transient overexpression lysate of checkpoint with forkhead and ring finger domains (CHFR), transcript variant 5 |
USD 436.00 |
|
LY431554 | Transient overexpression lysate of checkpoint with forkhead and ring finger domains (CHFR), transcript variant 1 |
USD 436.00 |
{0} Product Review(s)
Be the first one to submit a review