SIRPB1 (NM_001135844) Human Recombinant Protein

CAT#: TP326750

Purified recombinant protein of Homo sapiens signal-regulatory protein beta 1 (SIRPB1), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified SIRPB1 protein (Cat# TP326750). The protein was produced from HEK293T cells transfected with SIRPB1 cDNA clone (Cat# RC226750) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC226750 representing NM_001135844
  Red=Cloning site Green=Tags(s)
  
  MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG
  AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE
  LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS
  TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR
  GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA
  HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001129316
• Locus ID: 10326
• UniProt ID: Q5TFQ8
• Cytogenetics: 20p13
• Refseq ORF: 1194
• Synonyms: CD172b; SIRP-BETA-1
• Summary: The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
• Protein Families: Druggable Genome, Transmembrane