ABH2 (ALKBH2) (NM_001145374) Human Recombinant Protein
CAT#: TP326507
Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226507 protein sequence
Red=Cloning site Green=Tags(s) MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138846 |
Locus ID | 121642 |
UniProt ID | Q6NS38 |
Cytogenetics | 12q24.11 |
Refseq Size | 1206 |
Refseq ORF | 783 |
Synonyms | ABH2 |
Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400362 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428853 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428854 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400362 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
USD 436.00 |
|
LY428853 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
USD 436.00 |
|
LY428854 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
USD 436.00 |
|
PH310103 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) |
USD 3,255.00 |
|
PH326507 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) |
USD 3,255.00 |
|
PH326527 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847) |
USD 3,255.00 |
|
TP310103 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg |
USD 867.00 |
|
TP326527 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review