C1orf194 (NM_001122961) Human Recombinant Protein

CAT#: TP325142M

Recombinant protein of human chromosome 1 open reading frame 194 (C1orf194), 100 µg

Product Images

Coomassie blue staining of purified C1orf194 protein (Cat# TP325142). The protein was produced from HEK293T cells transfected with C1orf194 cDNA clone (Cat# RC225142) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225142 representing NM_001122961
  Red=Cloning site Green=Tags(s)
  
  MERSPSRRRRLEEAPKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNH
  HTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTA
  ATNGGYSRKKDGGFFST
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001116433
• Locus ID: 127003
• UniProt ID: Q5T5A4
• Cytogenetics: 1p13.3
• Refseq ORF: 471
• Summary: May play an important role for the maintenance of myelin-axon integrity (By similarity). May affect intracellular Ca(2+) homeostasis (PubMed:31199454).[UniProtKB/Swiss-Prot Function]