ARL9 (NM_206919) Human Recombinant Protein
CAT#: TP324926
Recombinant protein of human ADP-ribosylation factor-like 9 (ARL9), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224926 representing NM_206919
Red=Cloning site Green=Tags(s) MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAY HITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996802 |
Locus ID | 132946 |
UniProt ID | Q6T311 |
Cytogenetics | 4q12 |
Refseq Size | 836 |
Refseq ORF | 369 |
Summary | ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404168 | ARL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404168 | Transient overexpression lysate of ADP-ribosylation factor-like 9 (ARL9) |
USD 436.00 |
|
PH324926 | ARL9 MS Standard C13 and N15-labeled recombinant protein (NP_996802) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review