PQBP1 (NM_005710) Human Recombinant Protein
CAT#: TP323943
Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1, 20 µg
View other "PQBP1" proteins (22)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223943 protein sequence
Red=Cloning site Green=Tags(s) MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005701 |
Locus ID | 10084 |
UniProt ID | O60828, A0A0S2Z4V5 |
Cytogenetics | Xp11.23 |
Refseq Size | 1147 |
Refseq ORF | 795 |
Synonyms | MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS |
Summary | This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.[provided by RefSeq, Nov 2009] |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417119 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422317 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422318 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422319 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422320 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432617 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417119 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 |
USD 436.00 |
|
LY422317 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 |
USD 436.00 |
|
LY422318 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 |
USD 436.00 |
|
LY422319 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 |
USD 436.00 |
|
LY422320 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 |
USD 436.00 |
|
LY432617 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 |
USD 436.00 |
|
PH304269 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) |
USD 3,255.00 |
|
PH321161 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) |
USD 3,255.00 |
|
PH323943 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) |
USD 3,255.00 |
|
PH323994 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554) |
USD 3,255.00 |
|
PH324043 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) |
USD 3,255.00 |
|
TP304269 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP321161 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5, 20 µg |
USD 867.00 |
|
TP323994 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3, 20 µg |
USD 867.00 |
|
TP324043 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4, 20 µg |
USD 867.00 |
|
TP329617 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review