Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein
CAT#: TP323658
Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223658 protein sequence
Red=Cloning site Green=Tags(s) MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV QPLSLTVLLLLSLLSPQLCPAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009934 |
Locus ID | 1774 |
UniProt ID | P49184 |
Cytogenetics | Xq28 |
Refseq Size | 2665 |
Refseq ORF | 906 |
Synonyms | DNAS1L1; DNASEX; DNL1L; G4.8; XIB |
Summary | This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402010 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423155 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423156 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423157 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402010 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1 |
USD 436.00 |
|
LY423155 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2 |
USD 436.00 |
|
LY423156 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 3 |
USD 436.00 |
|
LY423157 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4 |
USD 436.00 |
|
PH323658 | DNASE1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001009934) |
USD 3,255.00 |
|
TP760294 | Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
|
TP760968 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
|
TP761603 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review