CHN 1 (CHN1) (NM_001822) Human Recombinant Protein
CAT#: TP322163
Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222163 representing NM_001822
Red=Cloning site Green=Tags(s) MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001813 |
Locus ID | 1123 |
UniProt ID | P15882 |
Cytogenetics | 2q31.1 |
Refseq Size | 2607 |
Refseq ORF | 1377 |
Synonyms | ARHGAP2; CHN; DURS2; NC; RHOGAP2 |
Summary | This gene encodes GTPase-activating protein for ras-related p21-rac and a phorbol ester receptor. It is predominantly expressed in neurons, and plays an important role in neuronal signal-transduction mechanisms. Mutations in this gene are associated with Duane's retraction syndrome 2 (DURS2). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400688 | CHN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422480 | CHN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400688 | Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 1 |
USD 436.00 |
|
LY422480 | Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 2 |
USD 436.00 |
|
PH302095 | CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001020372) |
USD 3,255.00 |
|
PH322163 | CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001813) |
USD 3,255.00 |
|
TP302095 | Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review