Thymosin beta 4 (TMSB4X) (NM_021109) Human Recombinant Protein
CAT#: TP322017L
Recombinant protein of human thymosin beta 4, X-linked (TMSB4X), 1 mg
Frequently bought together (2)
Other products for "Thymosin beta 4"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222017 representing NM_021109
Red=Cloning site Green=Tags(s) MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 4.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066932 |
Locus ID | 7114 |
UniProt ID | P62328, A2VCK8, Q0P5T0 |
Cytogenetics | Xp22.2 |
Refseq Size | 657 |
Refseq ORF | 132 |
Synonyms | FX; PTMB4; TB4X; TMSB4 |
Summary | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008] |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.